Pay in installments of $7.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jun 29 - Jul 4
For Your Every Summer RSVP, with Code: SUMMER15
Description
Does GLP 1 Help Lower Cholesterol? Effects and Clinical Use Fella Health GLP 1(7 36), amide107444 51 9HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR NH Hims and Hers likely to stop selling cheaper versions of GLP 1 medications GLP 1 microdosing is experimental and unauthorized UCLA Health Can You Take Weight Loss Injections with Sertraline Safely? Fella Health





Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.7 ★★★★★
Based on 2065 reviews
Sort
Product Reviews
★★★★★ 5
One of the best genral-purpose frothers out there, period
For the longest time, I've been looking for what seems like a unicorn -- something about the size of a mini-frother, but stronger than most. Almost a mini-submersion blender, really. And I still haven't found it. But the Maestri House frothers are about the closest thing I have found, which gives me hope that my unicorn might really exist someday.
Unlike cheaper frothers that almost always warn you off from actually washing them, Maestri House makes theirs waterproof. Seriously, you can froth sloppy and get it all up in the whisk end of this, then rinse the whole thing under the faucet if you want to. I really don't recommend that for the speed ring at the top of this one, as a precaution and because it should never be necessary, but you can if you have to.
Despite what I believe is cheaping out on the battery at just 1200mAh, it really can last a while, especially if you use it just once or twice a day. That it recharges using a USB-C connector is definitely a bonus.
The speed ring at the top is great feature, overall. It turns on at a slow speed and lets you crank it all the way up to a speed that I still haven't found a good use for. This provides a lot of flexibility, from gentle mixing to full-on danger frothing.
The included whisks can all be pretty handy. The whisk-whisk is good for things like two or three whole eggs, and the frother-whisk is good for general-purpose frothing. I really haven't figured out what the hook-whisk is for, because this isn't really made for handling any kind of dough, but it might work well for medium-to-thin batters.
Generally speaking, I can easily recommend Maestri House frothers over just about any other handheld frother you're going to find. For completeness, though, there are a few things that I think could be improved upon:
- The battery. Once you're into the $25+ range, I would expect a a high-current 2000mAh battery, for longevity and torque.
- The speed ring is flexible, but depending on your dexterity and grip it can be tricky to operate when dialing in just the right speed, with just one hand. And there's no "Off" button, so you have to wind it down to "Off". For some reason I often end up spinning it the other way and making it go faster instead. Muscle memory should take over eventually, but still. A dedicated On/Off button would be handy.
- For as beefy as this device feels, it doesn't handle thick liquids as well as I expected. The torque for basic mixing and frothing tasks is more than enough, but get this into thicker liquids or even four+ eggs, and it starts to bog down.
- Like most frothers of this type, the balance of the whisks is a variable thing. If a whisk shaft gets even a little bent this thing will shake, at least when started at slow speed. Things usually settle out at higher speeds, but I'd really like to see the shaft of the whisks made thicker and more rigid so they don't bend so easily.
- The frother whisk is good for what it is, and will quickly make great, basic foam. But unless you have supreme technique, it probably won't be good for any kind of latte art. This isn't a big problem in my mind, just something to be aware of.
- The stand is okay at best, and unstable at worst. It's just a bit short for some whisks, so some of them can bottom out on the counter and make it unstable. Bending the holder at the top back just a bit with some good pliers, so the whisks are tilted up and away from the bottom, can help. I'll probably end up designing a 3D printed stand to hold this more security, as well as store the extra whisks.
- I'm really not a fan of the textured finish on this model. It feels good enough, and the color is okay, but there are obvious seams on each side that, in my opinion, take away from the aesthetic. My call would be that whatever finish might be on the body, it should be seamless around the entire cylinder.
I want to be clear, that none of the comments above are intended to warn you off of this if you're looking for a very good, well made frother. I doubt that you can find anything better! I only mention them because nothing is perfect, and to temper the reader's expectations.
This brand, if not this specific model of frother, is almost certainly everything that you are looking for. If there's anything you don't like about this particular model on paper, I urge you to consider literally any other handheld frother they make.
It only falls short compared to my unicorn device, something I don't ever expect to see from anyone else, but really believe that Maestri House could deliver if they think there's a market.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
★★★★★ 4
It is an upgrade from PRODUKT
There's a lot to like with this frother. First off, it gets super-fast. It has good power but struggles a bit through thicker liquids at high speeds. I really got it exclusively for frothing milk and making really smooth chocolate milk. For those things it works well.
I like the stand. I just keep a napkin under it so it will drip dry after rinsing. It is easy to clean because you can just run it on about medium under running water. I've been using it for about 3 weeks now, probably once every other day, and I'm still on the first charge. To me that is excellent battery life.
It spins true, even at high speed. The key is to treat it well and probably make sure to use the stand instead of laying it on the counter. Because of the high RPM, any imbalance or bend at all is really going to be exaggerated.
The only thing I am not crazy about is the control. I don't like that I have to twist it off while in the liquid. I wish there was just a switch along with the adjustment ring.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
★★★★★ 5
Strong and Quiet
Color: Lux Cardinal Red, Size: Rechargeable Z1 Motor Max
Better than I expected. Works in two modes. Makes mixing a breeze.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
★★★★★ 5
Powerful!
Color: Lux Galaxy, Size: Rechargeable Z1 Motor Max
This thing is powerful and works great! I was hesitant about some of the negative reviews, but this is worth it so far. I use it every day and haven't charged it in the week that I've had it. Some people complained about turning it off.... It's not that hard. Just hold the button down for a second or two and it shuts off, no fuss. If you tap/press the button you'll cycle through the next speed and then off. I only use the first speed to make my protein shake and matcha. I feel like the high speed would just whip everything to pure foam! I'm hoping this lasts me a long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
★★★★★ 5
WORTH YOUR MONEY IF YOUR SECOND GUESSING, DONT!
Color: Lux Alpha Black, Size: Rechargeable Z1 Motor Max, Color: Lux Alpha Black, Size: Rechargeable Z1 Motor Max
THIS IS THE BEST! High powered, EXCELLENT FOR PROTEIN DRINKS!!!! The quality is SOLID! Super easy to clean, frothing is a 10, easy to store. Great stability. Battery life seems good too! All around Best Buy! Worth your money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
recommand products
Semaglutide vs Tirzepatide, which is better for you?
23.15
research chemical tirzepatide Buy Tirzepatide Research Peptide Australia
24.59
Do you have questions about GLP-1s? Ask here: https://www.reddit.com/user/ weightwatchers/comments/1j57i8z/hey_reddit_its_dr_michelle_cardel_weightwatchers/. Dr. Michelle Cardel, our Chief Nutrition Officer, will host a live AMA on Reddit to answer your
20.97
Tirzepatide vs Semaglutide
26.27
Tirzepatide vs. Semaglutide: Which Weight Loss Medication Is Right for You? |
27.81



